GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
0 items
Find us on Facebook
Product Details
ETA Satin Show Scarf with Logo
ETA Satin Show Scarf with Logo
ETA Satin Show Scarf with Logo
ETA Satin Show Scarf with Logo
Product Code:PRINT01
weight:20.0g
Product Condition:New
£1.45 inc. tax
Add to Cart
single - £1.45 -
2 up to 19 - £1.45 - per item
20 up to 99 - £1.40 - per item
100 up to 500 - £1.35 - per item
Description

Scarves are approximately 6.5" X 52" long, polyester satin and finished with a serged rolled edge.

Stock Logos are as shown, "60's Logo", "Aloha Logo". 

Logo can be printed on One Side or Both Sides.

Please email if you require your own Logo printed on the scarves.  This will incur a one off set-up fee of £10.00.

Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i